Wublast Clustal Result

 
Statistics:  BLASTP 2.0a19MP-WashU [05-Feb-1998] [Build irix6 01:48:13 05-Feb-1998].

Query: EGFR_HUMAN ID EGFR_HUMAN STANDARD; PRT; 1210 AA. - (1210 letters)

Database: GenPeptNew
Database size: 30,053 sequences; 9,242,616 total letters.

additional informations

  up-top   down-alignments
Result List: 

  Sequences producing High-scoring Segment Pairs  
Select    Display Sequence Sequence Description  High 
 Score 
 Smallest Sum 
 Probability 
P(N)
 N 
 GP_NEW:XXU53471_1  U53471 Xiphophorus xiphidium Xiphophoru... 3188 0.0 2
 GP_NEW:AF041838_1  AF041838 Rattus norvegicus Rattus norve... 3086 0.0 2
 GP_NEW:AF037332_1  AF037332 Homo sapiens Homo sapiens Eph-... 518 1.3e-64 2
 GP_NEW:AF037331_1  AF037331 Homo sapiens Homo sapiens Eph-... 514 4.8e-64 2
 GP_NEW:DRAJ5029_1  AJ005029 Danio rerio Danio rerio mRNA f... 494 5.6e-60 2
 GP_NEW:TFU58673_1  U58673 Tetraodon fluviatilis Tetraodon ... 407 4.2e-59 2
 GP_NEW:AF052730_1  AF052730 Drosophila melanogaster Drosop... 494 7.9e-59 4
 GP_NEW:RNEEKR_1  X59290 Rattus norvegicus Rat eek mRNA f... 445 5.2e-55 1
 GP_NEW:AF097738_1  AF097738 Homo sapiens Homo sapiens non-... 451 1.3e-54 1
 GP_NEW:AF021344_1  AF021344 Danio rerio Danio rerio develo... 429 9.2e-50 3
 GP_NEW:CEF11E6_1  Z81058 Caenorhabditis elegans Caenorhab... 412 8.3e-49 2
 GP_NEW:AF037164_1  AF037164 Drosophila melanogaster Drosop... 400 3.8e-47 2
 GP_NEW:AF044249_1  AF044249 Canis familiaris Canis familia... 335 7.8e-44 2
 GP_NEW:XLU39671_1  U39671 Xenopus laevis Xenopus laevis ne... 368 1.0e-42 1
 GP_NEW:XLU39670_1  U39670 Xenopus laevis Xenopus laevis ne... 368 1.1e-42 1
 GP_NEW:XLU39672_1  U39672 Xenopus laevis Xenopus laevis ne... 355 2.8e-41 1
 GP_NEW:CEK07F5_14  Z70284 Caenorhabditis elegans Caenorhab... 302 1.1e-33 1
 GP_NEW:CEM01B2_2  Z83116 Caenorhabditis elegans Caenorhab... 253 6.5e-33 3
 GP_NEW:CEW02A2_4  Z82286 Caenorhabditis elegans Caenorhab... 295 9.6e-33 1
 GP_NEW:CELF23C8_3  AF106583 Caenorhabditis elegans Caenorh... 295 4.4e-32 2
 GP_NEW:CEK07F5_3  Z70284 Caenorhabditis elegans Caenorhab... 284 3.7e-31 1
 GP_NEW:CEY69E1A_3  AL034365 Caenorhabditis elegans Caenorh... 280 1.6e-30 1
 GP_NEW:AF041792_1  AF041792 Gallus gallus Gallus gallus ty... 247 2.0e-28 1
 GP_NEW:AF110519_1  AF110519 Lycopersicon esculentum Lycope... 260 1.8e-27 1
 GP_NEW:AF110518_1  AF110518 Lycopersicon esculentum Lycope... 260 1.9e-27 1



  up-result list   down-additional infos
Alignments: 

Result 1 GP_NEW:XXU53471_1
 

U53471 Xiphophorus xiphidium Xiphophorus xiphidium receptor
tyrosine kinase Xmrk proto-oncogene mRNA, complete cds;
proto-oncogene. 1/99
Length = 1164

Score = 3188 (1483.8 bits), Expect = 0.0, Sum P(2) = 0.0
Identities = 618/1008 (61%), Positives = 761/1008 (75%)

Query: 11 LLALLAALCPASRALEEKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYV 70
    || || ::        ::||||||||::| |   ::|:| :::|:: | ||| ||||||   
Sbjct: 10 LLLLLLSIGRCCSTDPDRKVCQGTSNQMTML---DNHYLKMKKMYSGCNVVLENLEITYT 66
Query: 71 QRNYDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNYDAN-- 128
    | | |||||::|||| ||||||:| |  ||| ||::|||   || :: | |:|||  |    
Sbjct: 67 QENQDLSFLQSIQEVGGYVLIAMNEVSTIPLVNLRLIRGQNLYEGNFTLLVMSNYQKNPS 126
Query: 129 -----KTGLKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNH 183
         : |||:| : || ||| | |: |:|| |||||:| | |||  |  || :|:   |  
Sbjct: 127 SPDVYQVGLKQLQLSNLTEILSGGVKVSHNPLLCNVETINWWDIV--DKTSNPTMNLIPH 184
Query: 184 L--GSCQKCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCT 241
         |||||| | |||||  |  :||| ||::||:||: ||||  | |||: :|| |||  
Sbjct: 185 AFERQCQKCDPGCVNGSCWAPGPGHCQKFTKLLCAEQCNRRCRGPKPIDCCNEHCAGGCT 244
Query: 242 GPRESDCLVCRKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVV 301
    ||| :||| || | |: ||||||||  :|:  ::|:  ||  ||:||| |||:|| ||||  
Sbjct: 245 GPRATDCLACRDFNDDGTCKDTCPPPKIYDIVSHQVVDNPNIKYTFGAACVKECPSNYVV 304
Query: 302 TDHGSCVRACGADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKN 361
    |: |:|||:| |   |::|:| | || |:| | |||:|||||   :::::|:|||  | |  
Sbjct: 305 TE-GACVRSCSAGMLEVDENGKRSCKPCDGVCPKVCDGIGIGSLSNTIAVNSTNIGSFSN 363
Query: 362 CTSISGDLHILPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFE 421
    || |:||: :   :| ||      |:||: |  | |||||||:|:|  |||| | |  |:  
Sbjct: 364 CTKINGDIILNRNSFEGDPHYKIGPMDPEHLWNLTTVKEITGYLVIMWWPENMTSLSVFQ 423
Query: 422 NLEIIRGRTKQHGQFSLAVVSLN-ITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKL 480
    |||||||||     ||  || :: :  ||| ||||:| |:||:     | ||:||||::|  
Sbjct: 424 NLEIIRGRTTFSRGFSFVVVQVSHLQWLGLSSLKEVSAGNVILKNTPQLRYASTINWRRL 483
Query: 481 FGTSGQKTKIISNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCN 540
    | :  |  :    | ||      | |:  || :||| | |  |||| :| ||  ||  ||  
Sbjct: 484 FRSEDQSIEY-DARTEN------QTCNNECSEDGCW-PGPTMCVSCLHVDRGGRCVASCN 535
Query: 541 LLEGEPREFVENSECIQCHPECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVM 600
    ||:|||||   :  |:||| ||| |  ::|| | || || :|||: |||:|:  || |::  
Sbjct: 536 LLQGEPREAQVDGRCVQCHQECLVQTDSLTCYGPGPANCSKCAHFQDGPQCIPRCPHGML 595
Query: 601 GENNTLVWKYADAGHVCHLCHPNCTYGCTGPGLEGCPTNGPKIPSIATGMVGALLLLLVV 660
    |: :||:|||||    |: || ||| ||:|||| ||  :     |:| |:|  ||: ::|  
Sbjct: 596 GDGDTLIWKYADKMGQCQPCHQNCTQGCSGPGLSGCRGDIVSHSSLAVGLVSGLLITVIV 655
Query: 661 ALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS 720
    || | : :||| | ||||:||||||:||||||||||:||||| ||||||||||| :||||  
Sbjct: 656 ALLIVVLLRRRRIKRKRTIRRLLQEKELVEPLTPSGQAPNQAFLRILKETEFKKDRVLGS 715
Query: 721 GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI 780
    ||||||||||| |:|| ::|||||| |||||||| |:|:|||||||||||:|||||||||  
Sbjct: 716 GAFGTVYKGLWNPDGENIRIPVAIKVLREATSPKVNQEVLDEAYVMASVDHPHVCRLLGI 775
Query: 781 CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA 840
    |||| |||:|||||:||||||||:|:: |  |:||||||||||||||||:| ||||||||  
Sbjct: 776 CLTSAVQLVTQLMPYGCLLDYVRQHQERICGQWLLNWCVQIAKGMNYLEERHLVHRDLAA 835
Query: 841 RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY 900
    ||||:| | |||||||||:||| |:||||:| |||||||||||||||:  ||||||||||  
Sbjct: 836 RNVLLKNPNHVKITDFGLSKLLTADEKEYQAHGGKVPIKWMALESILQWTYTHQSDVWSY 895
Query: 901 GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK 960
    |||||||||||||||||||| ||:|:|| ||||||||||||:||||::||||||  |||:  
Sbjct: 896 GVTVWELMTFGSKPYDGIPAKEIASVLENGERLPQPPICTIEVYMIILKCWMIDPSSRPR 955
Query: 961 FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLI 1018
    ||||: |||:||||| |||||||:    ||||:|   :  |:  :|  |||||||||:  
Sbjct: 956 FRELVGEFSQMARDPSRYLVIQGN----LPSPSDRRLFSRLLSSDD--DVVDADEYLL 1007
Score = 116 (54.0 bits), Expect = 0.0, Sum P(2) = 0.0
Identities = 68/207 (32%), Positives = 90/207 (43%)

Query: 992 PTDSNFYRALMDEEDMDDVVDADEYLIPQQGFFSSPSTSR--TPLLSS----LSATSNNS 1045
    |:    :| |: |       |   ||: | |   |||  |  : ||||    : |       
Sbjct: 950 PSSRPRFRELVGEFSQM-ARDPSRYLVIQ-GNLPSPSDRRLFSRLLSSDDDVVDADEYLL 1007
Query: 1046 TVACIDRNGLQSC------PIKEDSFLQRYSSDPTGALTEDSIDDTFLPVPEYINQ--SV 1097
        |:| | : |      |::|:|   || ||||    |  :|       ||:||  |   
Sbjct: 1008 RYKRINRQGSEPCIPPNGHPVRENSIALRYISDPTQNALEKDLDGH-----EYVNQPGSE 1062
Query: 1098 PKRPAGSVQNPVYHNQPLNPAPSRDPHYQDPHSTAVGNPEYLNTVQ---PTCVNSTFDSP 1154
           : || | :      |      :    |    |||||| |   |   : : | |  
Sbjct: 1063 TSSRLSDIYNPNYEDLTDGWGPVSLSSQEA--ETNFSRPEYLNTNQNSLPLVSSGSMDDP 1120
Query: 1155 AHWAQKGSHQISLDNPDYQQDFFPKEAK--PNGIFKGSTAENAEYL 1198
     :  | |          ||  | |:      ||:|  : ||| |||  
Sbjct: 1121 DY--QAG----------YQAAFLPQTGALTGNGMFLPA-AENLEYL 1153
up-result list


Result 2 GP_NEW:AF041838_1
 

AF041838 Rattus norvegicus Rattus norvegicus receptor
tyrosine kinase (ERBB4) mRNA, complete cds. 1/99
Length = 1308

Score = 3086 (1436.3 bits), Expect = 0.0, Sum P(2) = 0.0
Identities = 616/1178 (52%), Positives = 794/1178 (67%)

Query: 17 ALCPASRALE---EKKVCQGTSNKLTQLGTFEDHFLSLQRMFNNCEVVLGNLEITYVQRN 73
    :|  |:| ::    : || || |||: |   | :: :|:: : |||||:|||||| :: |  
Sbjct: 12 SLLVAARTVQPSASQSVCAGTENKLSSLSDLEQQYRALRKYYENCEVVMGNLEITSIEHN 71
Query: 74 YDLSFLKTIQEVAGYVLIALNTVERIPLENLQIIRGNMYYENSYALAVLSNY--DANKTG 131
     |||||::|:|| ||||:|||    :|||||:||||   ||: ||||:  ||  | |  |  
Sbjct: 72 RDLSFLRSIREVTGYVLVALNQFRYLPLENLRIIRGTKLYEDRYALAIFLNYRKDGN-FG 130
Query: 132 LKELPMRNLQEILHGAVRFSNNPALCNVESIQWRDIVSSDFLSNMSMDFQNHLGSCQKCD 191
    |:|| ::|| |||:| |    |  ||  ::|:|:||| : : |||::        | :|   
Sbjct: 131 LQELGLKNLTEILNGGVYVDQNKFLCYADTIHWQDIVRNPWPSNMTLVSTIGSSGCGRCH 190
Query: 192 PSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGPRESDCLVC 251
     ||  | |||  | :|| ||: :||:|| ||| |   ||||| :|| ||:||:::||  |  
Sbjct: 191 KSC-TGRCWGPTENHCQTLTRTVCAEQCDGRCYGPYVSDCCHRECAGGCSGPKDTDCFAC 249
Query: 252 RKFRDEATCKDTCPPLMLYNPTTYQMDVNPEGKYSFGATCVKKCPRNYVVTDHGSCVRAC 311
      | |   |   ||   :|||||:|:: |   ||::|| |||||| |:|| |  ||||||  
Sbjct: 250 MNFNDSGACVTQCPQTFVYNPTTFQLEHNFNAKYTYGAFCVKKCPHNFVV-DSSSCVRAC 308
Query: 312 GADSYEMEEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHI 371
     :   |:||:|:: || |   | | |:||| |    : :::::||  | ||| |:|:|    
Sbjct: 309 PSSKMEVEENGIKMCKPCTDICPKACDGIGTGSLMSAQTVDSSNIDKFINCTKINGNLIF 368
Query: 372 LPVAFRGDSFTHTPPLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTK 431
    |     || :     :||::|:: :||:|||||| || || | ||   | ||  | ||    
Sbjct: 369 LVTGIHGDPYNAIDAIDPEKLNVFRTVREITGFLNIQTWPPNMTDFSVFSNLVTIGGRVL 428
Query: 432 QHGQFSLAVVSLNITSLGLRSLKEISDGDVIISGNKNLCYANTINWKKLFGTSGQKTKII 491
      |   | :    ||||  :|||||| |:: |: | |||| :||||  || |  |:  |   
Sbjct: 429 YSGLSLLILKQQGITSLQFQSLKEISAGNIYITDNSNLCYYHTINWTTLFSTVNQRIVIR 488
Query: 492 SNRGENSCKATGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVE 551
     ||   :| | | ||: ||| :||||| |  |:|||  |||: |:: ||| :|| |||    
Sbjct: 489 DNRRAENCTAEGMVCNHLCSNDGCWGPGPDQCLSCRRFSRGKICIESCNLYDGEFREFEN 548
Query: 552 NSECIQCHPECLPQAMNI-TCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENNTLVWKY 610
     | |::|  :|      : || | ||||| :|:|: |||:||: ||  : | |:  ::||  
Sbjct: 549 GSICVECDSQCEKMEDGLLTCHGPGPDNCTKCSHFKDGPNCVEKCPDVLQGANS-FIFKY 607
Query: 611 ADAGHVCHLCHPNCTYGCTGPGLEGC---PTNG----P---KIPSIATGMVGALLLLLVV 660
    ||    || |||||| || ||    |   |  |    |   : | || |::| | :|:::  
Sbjct: 608 ADQDRECHPCHPNCTQGCNGPTSHDCIYYPWTGHSTLPQHARTPLIAAGVIGGLFILVIM 667
Query: 661 ALGIGLFMRRRHIVRKRTLRRLLQERELVEPLTPSGEAPNQALLRILKETEFKKIKVLGS 720
    ||   :::||: | :|| ||| | | |||||||||| ||||| |||||||| |::|||||  
Sbjct: 668 ALTFAVYVRRKSIKKKRALRRFL-ETELVEPLTPSGTAPNQAQLRILKETELKRVKVLGS 726
Query: 721 GAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGI 780
    |||||||||:|:|||| |||||||| | | | |||| | :||| :|||||:||: ||||:  
Sbjct: 727 GAFGTVYKGIWVPEGETVKIPVAIKILNETTGPKANVEFMDEALIMASVDHPHLVRLLGV 786
Query: 781 CLTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAA 840
    ||: |:||:||||| ||||:|| ||||||||| |||||||||||| |||:||||||||||  
Sbjct: 787 CLSPTIQLVTQLMPHGCLLEYVHEHKDNIGSQLLLNWCVQIAKGMMYLEERRLVHRDLAA 846
Query: 841 RNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSY 900
    ||||||:| ||||||||||:||  :||||:|:|||:|||||||| | :| :|||||||||  
Sbjct: 847 RNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDVWSY 906
Query: 901 GVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPK 960
    |||:||||||| |||||||  ||  :||||||||||||||||||::||||||||||||||  
Sbjct: 907 GVTIWELMTFGGKPYDGIPTREIPDLLEKGERLPQPPICTIDVYIVMVKCWMIDADSRPK 966
Query: 961 FRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQ 1020
    |:||  |||:||||||||||||||:|| |||| || |:: |:||||::|::||:|||:||  
Sbjct: 967 FKELAAEFSRMARDPQRYLVIQGDDRMKLPSPNDSKFFQNLLDEEDLEDMMDAEEYLVPQ 1026
Query: 1021 QGFFSSPS-TSRTPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQRYSSDPTGALTE 1079
          |  |||| : |: |   ::   |    :| |    ::  |  :         |   
Sbjct: 1027 AFNIPPPIYTSRTRIDSNRSEIGHSPPPAYTPMSGSQFV-YQDGGFATQQGMPMPYTATT 1085
Query: 1080 DSIDDTFLPVPEYINQSVPKRPA--GSVQNPV------------YHNQPLNPAPSRDPHY 1125
     :| :   || :     :       |::: ||            |   |   || |:|    
Sbjct: 1086 STIPEA--PVAQGATAEMFDDSCCNGTLRKPVVPHVQEDSSTQRYSADPTVFAPERNPRA 1143
Query: 1126 QDPHSTAVGNPEYLNTVQPTCVNSTFDSPAHWAQKGSHQISLDNPDYQ 1173
    :      :  | :    |   :|   ::|    :|     :||||:|:  
Sbjct: 1144 ELDEEGYM-TPMHDKPKQEY-LNPVEENPFVSRRKNGDLQALDNPEYH 1189
Score = 142 (66.1 bits), Expect = 0.0, Sum P(2) = 0.0
Identities = 47/144 (32%), Positives = 69/144 (47%)

Query: 1068 RYSSDPTGALT--EDSIDDTFL-PVPEYINQSVPKRPAGSVQ---NPVYHNQPLNPAPSR 1121
    |   |  | :|   |     :| || |  |  | :|  | :|   || ||:    |  :   
Sbjct: 1142 RAELDEEGYMTPMHDKPKQEYLNPVEE--NPFVSRRKNGDLQALDNPEYHSASSGPPKAE 1199
Query: 1122 DPHYQDP-----HSTAVGNPEYL-NTVQ--PTCVNSTFDSPAHWAQKGSHQISLDNPDYQ 1173
    | :  :|      : |:|| ||: |::   |      ||:| :| :    : :| :|||   
Sbjct: 1200 DEYVNEPLYLNTFTNALGNAEYMKNSLLSVPEKAKKAFDNPDYWNHSLPPRSTLQHPDYL 1259
Query: 1174 QDFFPKEA-KPNGIFKGSTAENAEYL 1198
    |::  |   | ||  :   ||| |||  
Sbjct: 1260 QEYSTKYFYKQNGRIRPIVAENPEYL 1285
up-result list


Result 3 GP_NEW:AF037332_1
 

AF037332 Homo sapiens Homo sapiens Eph-like receptor
tyrosine kinase hEphB1b (EphB1) mRNA, complete cds; hEphB1
alternative spliced amino terminus. 1/99
Length = 973

Score = 518 (241.1 bits), Expect = 1.3e-64, Sum P(2) = 1.3e-64
Identities = 127/348 (36%), Positives = 203/348 (58%)

Query: 642 KIPSIA-TGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQE----------RELVE 690
    ::| || :   | : :: :||: | :  |:|   ::      ||           :  ::  
Sbjct: 527 QLPLIAGSAAAGVVFVVSLVAISI-VCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYID 585
Query: 691 PLTPSGEAPNQALLRILKETE--FKKIK-VLGSGAFGTVYKG-LWIPEGEKVKIPVAIKE 746
    | |   | ||:|:    || :  | ||: |:|:| || |||| | :| |:: :| ||||   
Sbjct: 586 PFTY--EDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLP-GKR-EIYVAIKT 641
Query: 747 LREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTST-VQLITQLMPFGCLLDYVREH 805
    |:   | |  :: | || :|   |:|:: || |:   |  | :||: |  | |  ::|::  
Sbjct: 642 LKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQN 701
Query: 806 KDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAE 865
            |:     || || || :   |||||||||:|| :    |::||||:: |  :  
Sbjct: 702 DGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDD 761
Query: 866 EKE--YHAE-GGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASE 922
      :  | :  |||:|::| | |:| :| :|  |||||||: :||:|:|| :||  :   :  
Sbjct: 762 TSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIRMWEVMSFGERPYWDMSNQD 821
Query: 923 ISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDP 975
    : : :|:  ||| |  |   :: :|: ||  | :|||:| |::    || |:|  
Sbjct: 822 VINAIEQDYRLPPPTDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNP 874
Score = 54 (25.1 bits), Expect = 1.3e-64, Sum P(2) = 1.3e-64
Identities = 56/247 (22%), Positives = 95/247 (38%)

Query: 221 GRCR---GKSPSD--CCHNQCAAG-CTGPRESD-CLVC-RKFRDEATCKDTCPPLMLYNP 272
    |||    |  | :   |   | ||     :|:: |  |    |  |     |     |    
Sbjct: 240 GRCTCKPGYEPENSVAC-KACPAGRFKASQEAEGCSHCPSNSRSPAEASPICTCRTGY-- 296
Query: 273 TTYQMDVNPEGKYSFGATCVKKCPRNYV-VTDHGSCV-------RACGAD--SYEM---- 318
      |: | :|        | |   ||| : : :  | :          | |  :| :      
Sbjct: 297 --YRADFDPP---EVACTSVPSGPRNVISIVNESSIILEWHPPRETGGRDDVTYNIICKK 351
Query: 319 -EEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFR 377
       || | | :|:     |   :|: | : |:|    :  :  :  :|:|     |   :  
Sbjct: 352 CRADG-RSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPPQ 410
Query: 378 GDSFTHTP-PLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQF 436
      |   |     |  : |:  |      : : :||:         : || |   |:| :|  
Sbjct: 411 HVSVNITTNQAAPSTVPIMHQVSATMRSITL-SWPQPEQPNGIILDYEI-RYYEKEHNEF 468
Query: 437 SLAVVSLNITSLGLRSLK 454
    : :: |    :  :  |:  
Sbjct: 469 NSSMASSQTNTARIDGLR 486
Score = 48 (22.3 bits), Expect = 8.6e-64, Sum P(2) = 8.6e-64
Identities = 33/150 (22%), Positives = 51/150 (34%)

Query: 499 CKATGQ----VCHALCSPEGCWGPEPRDCVSCRNVSRGR----ECVDKCNLLEGEPREFV 550
    |   |:    :    | |    | || : |:|:    ||    :  : |:      |     
Sbjct: 229 CNGDGEWMVPIGRCTCKP----GYEPENSVACKACPAGRFKASQEAEGCSHCPSNSRSPA 284
Query: 551 ENSECIQCHP-----ECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENN- 604
    | |    |       :  |  :  |    || | |   :  :    ::  |    |  :   
Sbjct: 285 EASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVN--ESSIILEWHPPRETGGRDD 342
Query: 605 ---TLVWKYADA-GHVCHLCHPNCTYGCTGPGLEGC 636
        :: |   | |  |  |  |  :     ||  |  
Sbjct: 343 VTYNIICKKCRADGRSCSRCDDNVEFVPRQLGLTEC 378
Score = 40 (18.6 bits), Expect = 1.8e+04, P = 1.0
Identities = 6/19 (31%), Positives = 12/19 (63%)

Query: 726 VYKGLWIPEGEKVKIPVAI 744
    : :|  ||  |:| :|: :  
Sbjct: 209 IARGTCIPNAEEVDVPIKL 227
up-result list


Result 4 GP_NEW:AF037331_1
 

AF037331 Homo sapiens Homo sapiens Eph-like receptor
tyrosine kinase hEphB1 (EphB1) mRNA, complete cds. 1/99
Length = 984

Score = 514 (239.2 bits), Expect = 4.8e-64, Sum P(2) = 4.8e-64
Identities = 127/348 (36%), Positives = 202/348 (58%)

Query: 642 KIPSIA-TGMVGALLLLLVVALGIGLFMRRRHIVRKRTLRRLLQE----------RELVE 690
    ::| || :   | : :: :||: | :  |:|   ::      ||           :  ::  
Sbjct: 538 QLPLIAGSAAAGVVFVVSLVAISI-VCSRKRAYSKEAVYSDKLQHYSTGRGSPGMKIYID 596
Query: 691 PLTPSGEAPNQALLRILKETE--FKKIK-VLGSGAFGTVYKG-LWIPEGEKVKIPVAIKE 746
    | |   | ||:|:    || :  | ||: |:|:| || |||| | :| |:: :| ||||   
Sbjct: 597 PFTY--EDPNEAVREFAKEIDVSFVKIEEVIGAGEFGEVYKGRLKLP-GKR-EIYVAIKT 652
Query: 747 LREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTST-VQLITQLMPFGCLLDYVREH 805
    |:   | |  :: | || :|   |:|:: || |:   |  | :||: |  | |  ::|::  
Sbjct: 653 LKAGYSEKQRRDFLSEASIMGQFDHPNIIRLEGVVTKSRPVMIITEFMENGALDSFLRQN 712
Query: 806 KDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAE 865
            |:     || || || :   |||||||||:|| :    |::||||:: |  :  
Sbjct: 713 DGQFTVIQLVGMLRGIAAGMKYLAEMNYVHRDLAARNILVNSNLVCKVSDFGLSRYLQDD 772
Query: 866 EKE--YHAE-GGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASE 922
      :  | :  |||:|::| | |:| :| :|  |||||||: :||:| || :||  :   :  
Sbjct: 773 TSDPTYTSSLGGKIPVRWTAPEAIAYRKFTSASDVWSYGIHMWEVMYFGERPYWDMSNQD 832
Query: 923 ISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDP 975
    : : :|:  ||| |  |   :: :|: ||  | :|||:| |::    || |:|  
Sbjct: 833 VINAIEQDYRLPPPTDCPAALHQLMLDCWQKDRNSRPRFAEIVNTLDKMIRNP 885
Score = 54 (25.1 bits), Expect = 4.8e-64, Sum P(2) = 4.8e-64
Identities = 56/247 (22%), Positives = 95/247 (38%)

Query: 221 GRCR---GKSPSD--CCHNQCAAG-CTGPRESD-CLVC-RKFRDEATCKDTCPPLMLYNP 272
    |||    |  | :   |   | ||     :|:: |  |    |  |     |     |    
Sbjct: 251 GRCTCKPGYEPENSVAC-KACPAGRFKASQEAEGCSHCPSNSRSPAEASPICTCRTGY-- 307
Query: 273 TTYQMDVNPEGKYSFGATCVKKCPRNYV-VTDHGSCV-------RACGAD--SYEM---- 318
      |: | :|        | |   ||| : : :  | :          | |  :| :      
Sbjct: 308 --YRADFDPP---EVACTSVPSGPRNVISIVNESSIILEWHPPRETGGRDDVTYNIICKK 362
Query: 319 -EEDGVRKCKKCEGPCRKVCNGIGIGEFKDSLSINATNIKHFKNCTSISGDLHILPVAFR 377
       || | | :|:     |   :|: | : |:|    :  :  :  :|:|     |   :  
Sbjct: 363 CRADG-RSCSRCDDNVEFVPRQLGLTECRVSISSLWAHTPYTFDIQAINGVSSKSPFPPQ 421
Query: 378 GDSFTHTP-PLDPQELDILKTVKEITGFLLIQAWPENRTDLHAFENLEIIRGRTKQHGQF 436
      |   |     |  : |:  |      : : :||:         : || |   |:| :|  
Sbjct: 422 HVSVNITTNQAAPSTVPIMHQVSATMRSITL-SWPQPEQPNGIILDYEI-RYYEKEHNEF 479
Query: 437 SLAVVSLNITSLGLRSLK 454
    : :: |    :  :  |:  
Sbjct: 480 NSSMASSQTNTARIDGLR 497
Score = 48 (22.3 bits), Expect = 3.3e-63, Sum P(2) = 3.3e-63
Identities = 33/150 (22%), Positives = 51/150 (34%)

Query: 499 CKATGQ----VCHALCSPEGCWGPEPRDCVSCRNVSRGR----ECVDKCNLLEGEPREFV 550
    |   |:    :    | |    | || : |:|:    ||    :  : |:      |     
Sbjct: 240 CNGDGEWMVPIGRCTCKP----GYEPENSVACKACPAGRFKASQEAEGCSHCPSNSRSPA 295
Query: 551 ENSECIQCHP-----ECLPQAMNITCTGRGPDNCIQCAHYIDGPHCVKTCPAGVMGENN- 604
    | |    |       :  |  :  |    || | |   :  :    ::  |    |  :   
Sbjct: 296 EASPICTCRTGYYRADFDPPEVACTSVPSGPRNVISIVN--ESSIILEWHPPRETGGRDD 353
Query: 605 ---TLVWKYADA-GHVCHLCHPNCTYGCTGPGLEGC 636
        :: |   | |  |  |  |  :     ||  |  
Sbjct: 354 VTYNIICKKCRADGRSCSRCDDNVEFVPRQLGLTEC 389
Score = 40 (18.6 bits), Expect = 1.9e+04, P = 1.0
Identities = 6/19 (31%), Positives = 12/19 (63%)

Query: 726 VYKGLWIPEGEKVKIPVAI 744
    : :|  ||  |:| :|: :  
Sbjct: 220 IARGTCIPNAEEVDVPIKL 238
up-result list


Result 5 GP_NEW:DRAJ5029_1
 

AJ005029 Danio rerio Danio rerio mRNA for Eph-like receptor
tyrosine kinase rtk8. 12/98
Length = 976

Score = 494 (229.9 bits), Expect = 5.6e-60, Sum P(2) = 5.6e-60
Identities = 117/334 (35%), Positives = 188/334 (56%)

Query: 651 VGALLLLLVVALGIGLFMR--RRHIVRKRTLRRLLQERELVEPLTP-SGEAPNQALLRIL 707
    :| |:|: || : :  | |  ||         : |  : :   : | : | ||:|:      
Sbjct: 546 IGLLILIAVVIVAVFCFRRSTRRRDPDPDKSGQFLMGQGIKVYIDPFTYEDPNEAVREFA 605
Query: 708 KETE--FKKIK-VLGSGAFGTVYKG-LWIPEGEKVKIPVAIKELREATSPKANKEILDEA 763
    || :  | ||: |:|:| || | :| | :| |:|    |||| |:   : |  :: | ||  
Sbjct: 606 KEIDVSFVKIEEVIGAGEFGEVCRGRLKVP-GKKENY-VAIKTLKGGYTDKQRRDFLSEA 663
Query: 764 YVMASVDNPHVCRLLGICLTST-VQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIA 822
     :|    :|::  | |:   |  | ::|: |  | |  ::| :        |:     ||  
Sbjct: 664 SIMGQFQHPNIIHLEGVITASCPVMILTEYMENGALDSFLRLNDGQFTPIQLVGMLRGIA 723
Query: 823 KGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLL--GAEEKEYHAE-GGKVPIK 879
     || || :   |||||||||:|| :    |::||||:: |   : :  | :  |||:||:  
Sbjct: 724 SGMKYLSEMSFVHRDLAARNILVNSNLVCKVSDFGLSRFLTENSSDPTYTSSLGGKIPIR 783
Query: 880 WMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPIC 939
    | | |:|  | :|  |||||||: :||:|:|| :||  :   :: : :|:  ||| || |  
Sbjct: 784 WTAPEAIAFRKFTSASDVWSYGIVMWEVMSFGERPYWDMSNQDVINAIEQDYRLPPPPEC 843
Query: 940 TIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDP 975
       :: :|: ||  :  |||:|  ::    :: |:|  
Sbjct: 844 PASLHQLMLDCWQKERSSRPRFCAIVSALDRLIRNP 879
Score = 45 (20.9 bits), Expect = 5.6e-60, Sum P(2) = 5.6e-60
Identities = 21/83 (25%), Positives = 30/83 (36%)

Query: 231 CCHNQCAAG-CTGPRESDCLVCRKFRDEATCKDTCPPLMLYNPT-TYQMDVNPEGKY--S 286
    |  |    | || |    |    ::    :    | |   | |  : :      |:|  |  
Sbjct: 225 CVDNSAPTGQCTAPPTMFCGEDGQWVGPPSSTCACKPG--YEPVDSDRCRACGLGQYKAS 282
Query: 287 FGATCVKKCPRNYVVTDHGSCVRAC 311
     | :  : || |      || :  |  
Sbjct: 283 VGGSLCRVCPDNSNTHSAGSSLCVC 307
Score = 37 (17.2 bits), Expect = 7.4e+03, Sum P(2) = 1.0
Identities = 9/27 (33%), Positives = 15/27 (55%)

Query: 436 FSLAVVSLNITSLGLRSLKEISDGDVI 462
    :|  :|   : | | |   ::|: |||  
Sbjct: 802 WSYGIVMWEVMSFGERPYWDMSNQDVI 828
up-result list


Result 6 GP_NEW:TFU58673_1
 

U58673 Tetraodon fluviatilis Tetraodon fluviatilis receptor
protein tyrosine kinase (RET) proto-oncogene, complete cds;
proto-oncogene. 2/99
Length = 1106

Score = 407 (189.4 bits), Expect = 4.2e-59, Sum P(2) = 4.2e-59
Identities = 81/207 (39%), Positives = 128/207 (61%)

Query: 814 LLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEG 873
    |:::  ||::|| || : :|||||||||||||   : :||:||||:: :  |:         
Sbjct: 843 LISFAWQISRGMQYLAEMKLVHRDLAARNVLVAEGRKMKISDFGLSRDVYEEDSYVKRSK 902
Query: 874 GKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERL 933
    |::|:||||:||:   ||| ||||||:|| :||::  |  || ||    : ::|: | |:  
Sbjct: 903 GRIPVKWMAIESLFDHIYTTQSDVWSFGVLLWEIVMLGGNPYPGIAPERLFNLLKTGYRM 962
Query: 934 PQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPT 993
     :|  |: ::| :|::||  :|| || | ::  |  ||    : || :         :|   
Sbjct: 963 ERPENCSEEMYNLMLRCWKQEADKRPTFSDISKELEKMMVKSRDYLDLAAS------TPA 1016
Query: 994 DSNFYRALMDEEDMDDVVDADEYLIPQ 1020
    |:  |   : |||   :|| :   :|:  
Sbjct: 1017 DALLYDDALSEEDTP-LVDCNNAPLPR 1042
Score = 128 (59.6 bits), Expect = 4.2e-59, Sum P(2) = 4.2e-59
Identities = 39/124 (31%), Positives = 62/124 (50%)

Query: 716 KVLGSGAFGTVYKGLWIP-EGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV 774
    | || | || | |      :|:     ||:| |:|  |    : :| |  ::  |::|||  
Sbjct: 720 KTLGEGEFGKVVKATAFRLKGKAGYTTVAVKMLKENASHSGLRSLLSEFTLLKQVNHPHV 779
Query: 775 CRLLGICLTS-TVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLE---D 830
     :: | |     : || :   :| | :::|| :  :|  |:        :  :|||   |  
Sbjct: 780 IKMYGACSQDGPLYLIVEYAKYGSLRNFLRESR-KVGPSYMGR---DANRNSSYLENPDD 835
Query: 831 RRLVHRDL 838
    | |   ||  
Sbjct: 836 RALTMGDL 843
Score = 37 (17.2 bits), Expect = 4.4e-58, Sum P(3) = 4.4e-58
Identities = 11/37 (29%), Positives = 17/37 (45%)

Query: 351 INATNIKHFKNCTSISGDLHILPVAFRGDSFTHTPPL 387
    :| |     :    :  :: ||||     : ||| ||  
Sbjct: 367 VNDTTYPGLEGTVLLHFNVTILPVHIFFSNITHTFPL 403
up-result list


Result 7 GP_NEW:AF052730_1
 

AF052730 Drosophila melanogaster Drosophila melanogaster
tyrosine kinase receptor protein (eph) mRNA, complete cds. 1/99
Length = 1019

Score = 494 (229.9 bits), Expect = 7.9e-59, Sum P(4) = 7.9e-59
Identities = 121/311 (38%), Positives = 167/311 (53%)

Query: 686 RELVEPLTPSGEAPNQALLRILKETEFKKIKV---LGSGAFGTVYKG-LWIPEGEKVKIP 741
    |  |:| |   | ||||:    :| :   | :   :| | || | :| | ||      |   
Sbjct: 653 RSYVDPHTY--EDPNQAIREFAREIDANYITIEAIIGGGEFGDVCRGRLKIPPNFVQDID 710
Query: 742 VAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGICLTST-VQLITQLMPFGCLLD 800
    |||| |:  :| ||  : | || :|   |:|:|  | |:   |  | :||: |  | |    
Sbjct: 711 VAIKTLKPGSSEKARCDFLTEASIMGHFDHPNVIYLQGVVTRSNPVMIITEYMENGSLDT 770
Query: 801 YVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAK 860
    ::| :     :  |:     || ||:|| |   ||||||||||||      || ||||::  
Sbjct: 771 FLRVNDGKFETLQLIVMLRGIASGMSYLSDMNYVHRDLAARNVLVNAQLICKIADFGLSR 830
Query: 861 LLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPA 920
     :      |   |||:|::| | |:|  | :|  |||||||| :||:|::| :||       
Sbjct: 831 EIENASDAYTTRGGKIPVRWTAPEAIAFRKFTSASDVWSYGVVLWEVMSYGERPYWNWSN 890
Query: 921 SEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLV 980
     ::   :|||  || |  |   :| :|: ||      || |  ::     :|| ||  |   
Sbjct: 891 QDVIKSIEKGLGLPAPMDCPEALYQLMLDCWQKQRTHRPTFASIVSTLDNLARQPQSLLT 950
Query: 981 IQGDERMHLPSP-TDSN 996
     :       ||| :| |  
Sbjct: 951 TR-------PSPESDGN 960
Score = 43 (20.0 bits), Expect = 7.9e-59, Sum P(4) = 7.9e-59
Identities = 10/31 (32%), Positives = 17/31 (54%)

Query: 642 KIPSIATGMVGALLLLLVVALGIGLFMRRRH 672
    :|  ||  |:  :| |::  :    ||| :|  
Sbjct: 575 QIRFIAGAMLTGVLFLVIFIIATVYFMRSKH 605
Score = 40 (18.6 bits), Expect = 7.9e-59, Sum P(4) = 7.9e-59
Identities = 17/55 (30%), Positives = 21/55 (38%)

Query: 189 KCDPSCPNGSCWGAGEENCQKLTKIICAQQCSGRCRGKSPSDCCHNQCAAGCTGP 243
    || |  || :    |   |:      ||   ||  |   |:|  |  | :    |  
Sbjct: 286 KCTPCPPNSNASKTGSPFCK------CA---SGYYR--HPNDGRHMPCYSPPAAP 329
Score = 38 (17.7 bits), Expect = 7.9e-59, Sum P(4) = 7.9e-59
Identities = 5/10 (50%), Positives = 7/10 (70%)

Query: 617 CHLCHPNCTY 626
    |::| ||  |  
Sbjct: 374 CNICSPNVVY 383
Score = 38 (17.7 bits), Expect = 7.9e-59, Sum P(4) = 7.9e-59
Identities = 6/11 (54%), Positives = 9/11 (81%)

Query: 264 CPPLMLYNPTT 274
    | | ::|||:|  
Sbjct: 377 CSPNVVYNPST 387
Score = 38 (17.7 bits), Expect = 1.5e-58, Sum P(4) = 1.5e-58
Identities = 9/28 (32%), Positives = 11/28 (39%)

Query: 295 CPRNYVVTDHGSCVRACGADSYEMEEDG 322
    || |   :  ||    | :  |    ||  
Sbjct: 290 CPPNSNASKTGSPFCKCASGYYRHPNDG 317
Score = 37 (17.2 bits), Expect = 1.6e+04, Sum P(3) = 1.0
Identities = 13/34 (38%), Positives = 16/34 (47%)

Query: 436 FSLAVVSLNITSLGLRSLKEISDGDVIISGNKNL 469
    :|  ||   : | | |     |: ||| |  | |  
Sbjct: 868 WSYGVVLWEVMSYGERPYWNWSNQDVIKSIEKGL 901
Score = 37 (17.2 bits), Expect = 3.8e+04, P = 1.0
Identities = 6/19 (31%), Positives = 12/19 (63%)

Query: 1090 PEYINQSVPKRPAGSVQNP 1108
    | | |::  : | |: ::|  
Sbjct: 264 PNYTNKTCTECPLGTFKSP 282
up-result list


Result 8 GP_NEW:RNEEKR_1
 

X59290 Rattus norvegicus Rat eek mRNA for eph and elk-related
kinase. 1/99
Length = 372

Score = 445 (207.1 bits), Expect = 5.2e-55, P = 5.2e-55
Identities = 98/283 (34%), Positives = 154/283 (54%)

Query: 716 KVLGSGAFGTV-YKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHV 774
    |::|||  | | |  | :| |::  :||||| |:   : :  :: | || :|   |:|::  
Sbjct: 6 KIIGSGESGEVCYGRLQVP-GQR-DVPVAIKALKAGYTERQRQDFLREAAIMGQFDHPNI 63
Query: 775 CRLLGICLTSTVQLI-TQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRL 833
     || |:     : :| |: |  | |  ::| |        |:     :  || || |     
Sbjct: 64 IRLEGVVTRGRLAMIVTEYMENGSLDAFLRTHDGQFTILQLVGMLKGVGAGMRYLSDLGY 123
Query: 834 VHRDLAARNVLVKTPQHVKITDFGLAKLLGAE-EKEYHAEGGKVPIKWMALESILHRIYT 892
    :||||||||:||      |::||||:: |  : |  |   |||:||:| | |:|  | ::  
Sbjct: 124 IHRDLAARNILVDGRLVCKVSDFGLSRALEDDPEAAYTTAGGKIPIRWTAPEAIAFRTFS 183
Query: 893 HQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWM 952
      |||||:|| :||:: :| :||  :   :: | :|:| ||| |  |   :: :|: ||   
Sbjct: 184 SASDVWSFGVVMWEVLAYGERPYWNMTNQDVISSVEEGYRLPAPMGCPRALHQLMLDCWH 243
Query: 953 IDADSRPKFRELIIEFSKMARDPQRYLVIQGDERMHLPSPTDSNF 997
     |   ||:|  ::     :   |:         |   |:   | |  
Sbjct: 244 KDRAQRPRFSHVVSVLEALVHSPESLRATATVSRCPAPAFARSCF 288
up-result list


Result 9 GP_NEW:AF097738_1
 

AF097738 Homo sapiens Homo sapiens non-receptor tyosine
kinase (TNK1) gene, complete cds. 1/99
Length = 661

Score = 451 (209.9 bits), Expect = 1.3e-54, P = 1.3e-54
Identities = 108/285 (37%), Positives = 157/285 (55%)

Query: 690 EPLTPSGEA-----PNQALLRILKETEFKKIKVLGSGAFGTVYKGLW-IPEGEKVKIPVA 743
    ||  ||        |   |  :: |    | ::|||| || |::||| :| |: |  |||  
Sbjct: 89 EPTLPSDSPRHLPEPEGGLKCLIPEGAVCKGELLGSGCFGVVHRGLWTLPSGKSV--PVA 146
Query: 744 IKELREATSPKANKEI---LDEAYVMASVDNPHVCRLLGICLTSTVQLITQLMPFGCLLD 800
    :| ||         |:   | |  || ::::||| || |: |   :|:: :| | | |    
Sbjct: 147 VKSLRVGPEGPMGTELGDFLREVSVMMNLEHPHVLRLHGLVLGQPLQMVMELAPLGSL-- 204
Query: 801 YVREHKDNIGSQYLLNW-CV---QIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDF 856
    : |          |:   |:   |:|  | ||  | ||||||| ||:|: :|: :|: ||  
Sbjct: 205 HARLTAPAPTPPLLVALLCLFLRQLAGAMAYLGARGLVHRDLATRNLLLASPRTIKVADF 264
Query: 857 GLAKLLGAEEKEYHAEGGK-VPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPY 915
    || : ||     |   | : :|  | | ||: |  ::  |||| :|||:||: : | :|:  
Sbjct: 265 GLVRPLGGARGRYVMGGPRPIPYAWCAPESLRHGAFSSASDVWMFGVTLWEMFSGGEEPW 324
Query: 916 DGIPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFREL 964
     |:|   |   ||   |||:||:|:  :| : ::||      || |  |  
Sbjct: 325 AGVPPYLILQRLEDRARLPRPPLCSRALYSLALRCWAPHPADRPSFSHL 373
Score = 38 (17.7 bits), Expect = 2.3e+04, P = 1.0
Identities = 5/8 (62%), Positives = 5/8 (62%)

Query: 515 CWGPEPRD 522
    || | | |  
Sbjct: 359 CWAPHPAD 366
up-result list


Result 10 GP_NEW:AF021344_1
 

AF021344 Danio rerio Danio rerio developmental receptor
tyrosine kinase (Dtk) mRNA, complete cds; Tyro3. 1/99
Length = 874

Score = 429 (199.7 bits), Expect = 9.2e-50, Sum P(3) = 9.2e-50
Identities = 100/262 (38%), Positives = 151/262 (57%)

Query: 716 KVLGSGAFGTVYKGLWIPEGEKVKIPVAIKELR-EATSPKANKEILDEAYVMASVDNPHV 774
    ::|| | ||:| :     |    :  ||:| |: :  |    :: | ||  |    :|:|  
Sbjct: 501 RMLGKGEFGSVREAFLKSENNSGQ-KVAVKVLKTDINSSSDIEQCLKEAAYMKDFHHPNV 559
Query: 775 CRLLGICLTSTVQ----LITQLMPF---G-----CLLDYVREHKDNIGSQYLLNWCVQIA 822
     :|:|: |    |    :   ::||   |      |:  : :    :  | |: : : ||  
Sbjct: 560 IQLIGVSLHRRAQQRLPIPMVILPFMKHGDLHTFLLMSRLGDEPFTVSQQILIQFMLDIA 619
Query: 823 KGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGG--KVPIKW 880
    :|| || :: ::|||||||| ::     | : ||||:| : :   :|: :|   |:|:||  
Sbjct: 620 RGMEYLSNKNIIHRDLAARNCMLNENMSVCVADFGLSKKIYS--GDYYRQGSVSKLPVKW 677
Query: 881 MALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICT 940
    :||||:   :|| |||||::|||:||:|| |  || |:  |||   | ||||| ||| |   
Sbjct: 678 IALESLADNVYTTQSDVWAFGVTMWEIMTRGQTPYPGVENSEIYEYLIKGERLKQPPDCP 737
Query: 941 IDVYMIMVKCWMIDADSRPKFRELI 965
     |:| ||  ||      || |: ||  
Sbjct: 738 ADIYEIMHSCWSPVPKCRPSFQHLI 762
Score = 42 (19.5 bits), Expect = 9.2e-50, Sum P(3) = 9.2e-50
Identities = 6/24 (25%), Positives = 13/24 (54%)

Query: 565 QAMNITCTGRGPDNCIQCAHYIDG 588
    :: |:||   ||   ::   :: |  
Sbjct: 132 ESFNLTCAASGPPEPVEVLWWLGG 155
Score = 37 (17.2 bits), Expect = 9.2e-50, Sum P(3) = 9.2e-50
Identities = 6/9 (66%), Positives = 8/9 (88%)

Query: 1115 LNPAPSRDP 1123
    ||||| ::|  
Sbjct: 772 LNPAPVKEP 780
up-result list


Result 11 GP_NEW:CEF11E6_1
 

Z81058 Caenorhabditis elegans Caenorhabditis elegans cosmid
F11E6, complete sequence; predicted using Genefinder; similar to
Eukaryotic protein kinase domain; cDNA EST yk457b3.5 come
Length = 442

Score = 412 (191.8 bits), Expect = 8.3e-49, Sum P(2) = 8.3e-49
Identities = 115/322 (35%), Positives = 173/322 (53%)

Query: 696 GEAPNQALLRILKETEFKKIK-VLGSGAFGTVYKG-LWIPEGEKVKIPVAIKELR-EATS 752
    |    |:|  :|  :|   :: ::| | || ||:| :  | |    ||||:| |: |     
Sbjct: 119 GSDLRQSLQGLLLPSEAVVLETIVGKGYFGNVYRGRMRDPAGRL--IPVAVKTLKGERAR 176
Query: 753 PKANKE-ILDEAYVMASVDNPHVCRLLGICLTSTVQ--LITQLMPFGCLLDYVREHKDNI 809
      |: |  | |  ||  :|:|||  |||| ::      ::   |  | |  |: :    :  
Sbjct: 177 DIAHIEKFLREGVVMKHLDHPHVLSLLGISISPAGNPWVVLPYMEGGDLKTYIADPNRAL 236
Query: 810 GSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLA-KLLGAEEKE 868
        ||::  |:|:||:||  :  ||||||||| ::   : ||: |||||  ||  |     
Sbjct: 237 CVLELLDFAHQVAQGMSYLAAQHFVHRDLAARNCMISADRIVKVADFGLAVDLLDKESYI 296
Query: 869 YHAEGG--KVPIKWMALESIL-HRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISS 925
      :| |  ::|:||:| ||:   |:::  :||||:|| :|||:|  : ||  :  :::    
Sbjct: 297 DESETGPARLPLKWLAPESLRDRRVFSSATDVWSFGVLMWELLTRAASPYGEVSNTKVRH 356
Query: 926 ILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMAR----DPQRYLVI 981
     || | |||||  |   :| :|  ||    : || |  |      : :    ||    |   
Sbjct: 357 YLETGMRLPQPTHCPDIIYDLMQCCWRSTPEDRPDFVFLSHRLRALLQENTPDPFTRRVR 416
Query: 982 QGDERMHLPS-PTD--SNFYRALM 1002
     | |:  ||  |    :|:: | |  
Sbjct: 417 PGAEQFLLPVLPGRLFTNYFAAQM 440
Score = 37 (17.2 bits), Expect = 8.3e-49, Sum P(2) = 8.3e-49
Identities = 9/34 (26%), Positives = 18/34 (52%)

Query: 333 CRKVCNGIGIGEFKDSLSINATNIKHFKNCTSIS 366
    |:|  |  |:|    |    :|:  ::  |:::|  
Sbjct: 73 CQKGTNSGGLGAGAISPKSFSTSPSQWTTCSTVS 106
up-result list


Result 12 GP_NEW:AF037164_1
 

AF037164 Drosophila melanogaster Drosophila melanogaster
receptor tyrosine kinase (Nrk) gene, complete cds; Dnrk; similar to
the product encoded in GenBank Accession Number AB001420
Length = 724

Score = 400 (186.2 bits), Expect = 3.8e-47, Sum P(2) = 3.8e-47
Identities = 98/284 (34%), Positives = 156/284 (54%)

Query: 696 GEAPNQALLRI-LKETEFKKIKVLGSGAFGTVYK----GLWIPEGEKVKIPVAIKELREA 750
    |  ||  | ::     :   :: || |||| |::    || :|: | :   ||:| |::   
Sbjct: 424 GTKPNARLEKLEYPRGDIVYVRSLGQGAFGRVFQARAPGL-VPDQEDLL--VAVKMLKDD 480
Query: 751 TSPKANKEILDEAYVMASVDNPHVCRLLGIC-LTSTVQLITQLMPFGCLLDYVRE----- 804
     | :   :   || ::|  |:|:: ||||:| |   : |: : |  | | :::|        
Sbjct: 481 ASDQMQMDFEREACLLAEFDHPNIVRLLGVCALGRPMCLLFEYMAPGDLSEFLRACSPYA 540
Query: 805 -H----KDNI--GSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFG 857
     |    :| :     :||     || || || :|: |||||| || |:     ||| |||  
Sbjct: 541 THQAPTRDRLQLNELHLLQMAANIAAGMLYLSERKFVHRDLATRNCLINEHMAVKIADFG 600
Query: 858 LAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDG 917
    |:  :  ::     |   :||:|| |||||:  :: :||||:||: :||: :|  :|| |  
Sbjct: 601 LSHKIYLQDYYKGDENDFIPIRWMPLESILYNKFSLESDVWAYGICLWEVFSFALQPYFG 660
Query: 918 IPASEISSILEKGERLPQPPICTIDVYMIMVKCWMIDADSRPKFREL 964
    :   |:   :::|  |  |    : || :| :||      || | |:  
Sbjct: 661 LTHEEVIKYIKEGNVLGCPDNTPLSVYALMRRCWNRKPSERPGFAEI 707
Score = 45 (20.9 bits), Expect = 3.8e-47, Sum P(2) = 3.8e-47
Identities = 20/64 (31%), Positives = 24/64 (37%)

Query: 499 CKA--TGQVCHALCSPEGCWGPEPRDCVSCRNVSRGRECVDKCNLLEGEPREFVENSECI 556
    ||   |||| ::|  | | |  |          :   | :     | |  ||  |   |   
Sbjct: 78 CKEYLTGQVWYSLEDPTGGWKNEQV------TTALWDELISD---LTGLCREAAEKMLCA 128
Query: 557 QCHPEC 562
       | |  
Sbjct: 129 YAFPNC 134
Score = 38 (17.7 bits), Expect = 3.6e-46, Sum P(2) = 3.6e-46
Identities = 10/36 (27%), Positives = 15/36 (41%)

Query: 562 CLPQAMNITCTGRGPDNC-IQCAHYIDGPHCVKTCPA 597
    |   |  : |    | || ::    :  | | : | |  
Sbjct: 118 CREAAEKMLCAYAFP-NCHMEGGRAVKAPLCFEDCQA 153
up-result list


Result 13 GP_NEW:AF044249_1
 

AF044249 Canis familiaris Canis familiaris receptor tyrosine
kinase c-kit mRNA, complete cds. 1/99
Length = 975

Score = 335 (155.9 bits), Expect = 7.8e-44, Sum P(2) = 7.8e-44
Identities = 67/167 (40%), Positives = 104/167 (62%)

Query: 814 LLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEG 873
    ||::  |:|||| :|  :  :||||||||:|:   :  || |||||: :   :  |  :|  
Sbjct: 768 LLSFSYQVAKGMAFLASKNCIHRDLAARNILLTHGRITKICDFGLARDIK-NDSNYVVKG 826
Query: 874 G-KVPIKWMALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPA-SEISSILEKGE 931
      ::|:|||| ||| : :|| :|||||||: :||| : || || |:|  |:   ::::|   
Sbjct: 827 NARLPVKWMAPESIFNCVYTFESDVWSYGIFLWELFSLGSSPYPGMPVDSKFYKMIKEGF 886
Query: 932 RLPQPPICTIDVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYL 979
    |:  |     ::| ||  ||  |   || |::::    |   |   ::  
Sbjct: 887 RMLSPEHAPAEMYDIMKTCWDADPLKRPTFKQIVQLIEKQISDSTNHI 934
Score = 90 (41.9 bits), Expect = 7.8e-44, Sum P(2) = 7.8e-44
Identities = 27/96 (28%), Positives = 49/96 (51%)

Query: 716 KVLGSGAFGTVYKGL-WIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNP-H 773
    | ||:|||| | :   :        : ||:| |: :      : :: |  |:: : |  :  
Sbjct: 592 KTLGAGAFGKVVEATAYGLIKSDAAMTVAVKMLKPSAHLTEREALMSELKVLSYLGNHMN 651
Query: 774 VCRLLGICLTSTVQL-ITQLMPFGCLLDYVREHKDN 808
    :  ||| |      | ||:   :| ||:::|  :|:  
Sbjct: 652 IVNLLGACTVGGPTLVITEYCCYGDLLNFLRRKRDS 687
up-result list


Result 14 GP_NEW:XLU39671_1
 

U39671 Xenopus laevis Xenopus laevis neurotrophin receptor B
xTrkB-alpha (xTrkB) mRNA, splice variant 2, complete cds; splice
variant 2; tyrosine kinase. 1/99
Length = 811

Score = 368 (171.3 bits), Expect = 1.0e-42, P = 1.0e-42
Identities = 94/279 (33%), Positives = 153/279 (54%)

Query: 718 LGSGAFGTVYKG-LWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCR 776
    || |||| |:    :    |: || ||:| |::| |  | |:   || :: :: : |: :  
Sbjct: 533 LGEGAFGKVFLAECYNLYPEQDKILVAVKTLKDA-SDNARKDFHREAELLTNLQHEHIVK 591
Query: 777 LLGICLTST-VQLITQLMPFGCLLDYVREHK-DNI----GSQ-------YLLNWCVQIAK 823
      |:|:    : :: : |  | |  ::| |  | :    |::        :|:   |||   
Sbjct: 592 FYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNRPAELTQSQMLHIAQQIAA 651
Query: 824 GMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGK--VPIKWM 881
    || ||  :  |||||| || ||     ||| |||:::       :|:  ||   :||:||  
Sbjct: 652 GMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSR--DVYSTDYYRVGGHTMLPIRWM 709
Query: 882 ALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTI 941
      |||::| :| :||||| || :||: |:| :|:  :  :|:   : :|  | :|  |    
Sbjct: 710 PPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPK 769
Query: 942 DVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQG 983
    :|| :|: ||  :   |   :|:      :::    || | |  
Sbjct: 770 EVYDLMLGCWQREPHMRLNIKEIHSLLQNLSKASPVYLDILG 811
up-result list


Result 15 GP_NEW:XLU39670_1
 

U39670 Xenopus laevis Xenopus laevis neurotrophin receptor B
xTrkB-alpha (xTrkB) mRNA, splice variant 1, complete cds; splice
variant 1; tyrosine kinase. 1/99
Length = 821

Score = 368 (171.3 bits), Expect = 1.1e-42, P = 1.1e-42
Identities = 94/279 (33%), Positives = 153/279 (54%)

Query: 718 LGSGAFGTVYKG-LWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCR 776
    || |||| |:    :    |: || ||:| |::| |  | |:   || :: :: : |: :  
Sbjct: 543 LGEGAFGKVFLAECYNLYPEQDKILVAVKTLKDA-SDNARKDFHREAELLTNLQHEHIVK 601
Query: 777 LLGICLTST-VQLITQLMPFGCLLDYVREHK-DNI----GSQ-------YLLNWCVQIAK 823
      |:|:    : :: : |  | |  ::| |  | :    |::        :|:   |||   
Sbjct: 602 FYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNRPAELTQSQMLHIAQQIAA 661
Query: 824 GMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGK--VPIKWM 881
    || ||  :  |||||| || ||     ||| |||:::       :|:  ||   :||:||  
Sbjct: 662 GMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSR--DVYSTDYYRVGGHTMLPIRWM 719
Query: 882 ALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTI 941
      |||::| :| :||||| || :||: |:| :|:  :  :|:   : :|  | :|  |    
Sbjct: 720 PPESIMYRKFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPK 779
Query: 942 DVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQG 983
    :|| :|: ||  :   |   :|:      :::    || | |  
Sbjct: 780 EVYDLMLGCWQREPHMRLNIKEIHSLLQNLSKASPVYLDILG 821
up-result list


Result 16 GP_NEW:XLU39672_1
 

U39672 Xenopus laevis Xenopus laevis neurotrophin receptor B
xTrkB-beta (xTrkB) mRNA, partial cds; tyrosine kinase. 1/99
Length = 486

Score = 355 (165.2 bits), Expect = 2.8e-41, P = 2.8e-41
Identities = 91/279 (32%), Positives = 152/279 (54%)

Query: 718 LGSGAFGTVYKG-LWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCR 776
    || |||| |:    :    |: || ||:| |::| |  | |:   || :: :: : :: :  
Sbjct: 208 LGEGAFGKVFLAECYNLYLEQDKILVAVKTLKDA-SDNARKDFHREAELLTNLQHENIVK 266
Query: 777 LLGICLTST-VQLITQLMPFGCLLDYVREHK-DNI----GS-------QYLLNWCVQIAK 823
      |:|:    : :: : |  | |  ::| |  | :    |:         :::   |||   
Sbjct: 267 FYGVCVEGDPLIMVFEYMKHGDLNKFLRAHGPDAVLMAEGNLLAELTQSQMIHISQQIAA 326
Query: 824 GMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGK--VPIKWM 881
    || ||  :  |||||| || ||     ||| |||:::       :|:  ||   :||:||  
Sbjct: 327 GMVYLASQHFVHRDLATRNCLVGENLLVKIGDFGMSR--DVYSTDYYRVGGHTMLPIRWM 384
Query: 882 ALESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTI 941
      |||::| :| :||||| || :||: |:| :|:  :  :|:   : :|  | :|  |    
Sbjct: 385 PPESIMYRRFTTESDVWSLGVVLWEIFTYGKQPWYQLSNNEVIECITQGRVLQRPRTCPK 444
Query: 942 DVYMIMVKCWMIDADSRPKFRELIIEFSKMARDPQRYLVIQG 983
    ::| :|: ||  :   |   :|:      :::    || | |  
Sbjct: 445 EIYDLMLGCWQREPHMRLNIKEIHSLLQNLSKASPVYLDILG 486
up-result list


Result 17 GP_NEW:CEK07F5_14
 

Z70284 Caenorhabditis elegans Caenorhabditis elegans cosmid
K07F5, complete sequence; similar to tyrosine-protein kinase
(FES/FPS subfamily). 12/98
Length = 534

Score = 302 (140.6 bits), Expect = 1.1e-33, P = 1.1e-33
Identities = 71/204 (34%), Positives = 117/204 (57%)

Query: 706 ILKETEFKKIKVLGSGAFGTVYKGLWIPEGEKVKIPVAIKEL-REATSPKANKEILDEAY 764
    ||: :       || |||| | |  ::| |  |   ||:| |  :|  |:   :  :||   
Sbjct: 161 ILQHSSIALENQLGRGAFGEVIKAKYVPMGATVPTEVAVKRLIGDAKRPQL-VDFCNEAN 219
Query: 765 VMASVDNPHVCRLLGIC-LTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAK 823
    :|  ::: ::  | |   |   : |: : :| | |  |: :   |: |: :: : ::||   
Sbjct: 220 IMTLLEHKNIVALYGFASLQQPIMLVIEFVPGGDLRKYL-QRTPNVPSKQIIKFAMEIAS 278
Query: 824 GMNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEG-GKVPIKWMA 882
    || :|  : ::|||||||| |:    :|||:||||:      | |   :   | ||:|::  
Sbjct: 279 GMKHLSSKNVIHRDLAARNCLITKELNVKISDFGLS----VNESETKMKSLKKAPIRWLS 334
Query: 883 LESILHRIYTHQSDVWSYGVTVWELMT 909
     |:    ::  ::||||||| : ||||  
Sbjct: 335 PETFSKGLFNEKTDVWSYGVLLTELMT 361
up-result list


Result 18 GP_NEW:CEM01B2_2
 

Z83116 Caenorhabditis elegans Caenorhabditis elegans cosmid
M01B2, complete sequence; similar to tyrosine-protein kinase
(KIN15/KIN16 subfamily). 12/98
Length = 483

Score = 253 (117.8 bits), Expect = 6.5e-33, Sum P(3) = 6.5e-33
Identities = 56/137 (40%), Positives = 80/137 (58%)

Query: 832 RLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGK---VPIKWMALESILH 888
    : |||||| ||| ||  : ::| |||||:   :::  |  :      :|| |:| |      
Sbjct: 310 KCVHRDLALRNVFVKRNKMIRIGDFGLARH-HSKKSYYRMQCNPDTPLPIFWLAPECFNE 368
Query: 889 RIYTHQSDVWSYGVTVWELMTFGSKPYDGI---PASEISSILEKGERLPQPPICTIDVYM 945
      :|  :||||||| ::|| : |  ||  :   |: ::   |:|| ||  |  |  ::|   
Sbjct: 369 SKFTEMTDVWSYGVCLFELFSLGESPYKKLHNSPSYDVVHYLKKGYRLSAPRYCNAEIYE 428
Query: 946 IMVKCWMIDADSRPKFRE 963
     |: || |||  |||| |  
Sbjct: 429 FMLYCWNIDATLRPKFTE 446
Score = 84 (39.1 bits), Expect = 6.5e-33, Sum P(3) = 6.5e-33
Identities = 25/69 (36%), Positives = 40/69 (57%)

Query: 716 KVLGSGAFGTVYKGLW--IPE--GEKVKIPVAIKELREATSPKANKEILDEAYVMASVD- 770
    |  | | || | | |   | :  || |:: ||:|:  ::|    :| ||||  :| ::    
Sbjct: 137 KQFGQGNFGKVNKALLKLINQKTGEVVRMDVAVKKPADSTDKSQDKLILDEIKLMCAIGK 196
Query: 771 NPHVCRLLG 779
    :|:|  ::|  
Sbjct: 197 HPNVLAIVG 205
Score = 44 (20.5 bits), Expect = 6.5e-33, Sum P(3) = 6.5e-33
Identities = 9/22 (40%), Positives = 13/22 (59%)

Query: 807 DNIGSQYLLNWCVQIAKGMNYL 828
    | : :  | ::  ||| || ||  
Sbjct: 263 DELSTSDLYSFAYQIANGMEYL 284
up-result list


Result 19 GP_NEW:CEW02A2_4
 

Z82286 Caenorhabditis elegans Caenorhabditis elegans cosmid
W02A2, complete sequence; predicted using Genefinder; similar to
Eukaryotic protein kinase domain. 12/98
Length = 500

Score = 295 (137.3 bits), Expect = 9.6e-33, P = 9.6e-33
Identities = 70/193 (36%), Positives = 114/193 (59%)

Query: 717 VLGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCR 776
    :||:|||| | |  :|| |    : ||:|           :|   || :| :: : :| :  
Sbjct: 107 ILGNGAFGEVLKARYIPRGHTNGVEVAVKRALGTAQRDQMQEFCHEAQIMGTLKHDNVVK 166
Query: 777 LLGIC-LTSTVQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVH 835
    | ||  |   : |: :|:  | |  |::    :| :: |: : : || || :|  ::::|  
Sbjct: 167 LYGIASLEQPIMLVMELITGGDLKKYLQS-TPSIPNRQLIAFALDIANGMRHLVIKKVIH 225
Query: 836 RDLAARNVLVKTPQ-HVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQ 894
    ||||||| |:  |  :|||:|||||  : | |     : || | :|:| |:    |:  :  
Sbjct: 226 RDLAARNCLISRPTLQVKISDFGLA--VQATEVIVK-KLGKAPTRWLAPETFQKGIFNEK 282
Query: 895 SDVWSYGVTVWELMT 909
    :||||:|| : |::|  
Sbjct: 283 TDVWSFGVVLTEILT 297
up-result list


Result 20 GP_NEW:CELF23C8_3
 

AF106583 Caenorhabditis elegans Caenorhabditis elegans
cosmid F23C8; contains similarity to eukaryotic protein kinase
domain (Pfam: PF00069, Score=206.2, E=5.1e-58, N=1) and to Src
Length = 417

Score = 295 (137.3 bits), Expect = 4.4e-32, Sum P(2) = 4.4e-32
Identities = 77/259 (29%), Positives = 144/259 (55%)

Query: 707 LKETEFKKIKVLGSGAFGTVYKG-LWIPEGEKVKIPVAIKELREATSPKANKEILDEAYV 765
    :: :: :  | || |||| |:|| | :  |      :   :| |: : :  |||: || :  
Sbjct: 115 IEHSQVELTKKLGEGAFGEVWKGKLTLKNGNVENCAIKTAKL-ESLNKEQIKEIMREARL 173
Query: 766 MASVDNPHVCRLLGICLTST-VQLITQLMPFGCLLDYVREHKDNIGSQYLLNWCVQIAKG 824
    | ::|:|:| :  |:  :   : :| :|   | |  |::::  |:     :    | | |  
Sbjct: 174 MRNLDHPNVVKFYGVGASQEPLYVIMELADCGALDSYLQKNP-NLVPDKKMEMIYQAACG 232
Query: 825 MNYLEDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAE-GGKVPIKWMAL 883
    ::|: :::|:|||:|||| |    | ||| ||||::    |   |  :   ||||:|:|   
Sbjct: 233 ISYMHEKKLLHRDIAARNCLYGGGQ-VKIADFGLSR----EGISYVMDLTKKVPIRWLAP 287
Query: 884 ESILHRIYTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTIDV 943
    |::   ||: ::||:::|:  ||:   | :||  :  :::   :  | |:   |:  :|   
Sbjct: 288 ETLKAGIYSPKTDVFAFGIMAWEITENGKEPYPDMRVADVVGKVRNGYRMRFDPVF-VDF 346
Query: 944 YM---IMVKCWMIDADSRPKFRELI 965
         :   ||  :   |    :::  
Sbjct: 347 RFGDYVTKHCWAENPADRVSMADVL 371
Score = 41 (19.1 bits), Expect = 6.2e+03, P = 1.0
Identities = 8/17 (47%), Positives = 9/17 (52%)

Query: 515 CWGPEPRDCVSCRNVSR 531
    ||   | | ||  :| |  
Sbjct: 356 CWAENPADRVSMADVLR 372
Score = 37 (17.2 bits), Expect = 4.4e-32, Sum P(2) = 4.4e-32
Identities = 9/31 (29%), Positives = 13/31 (41%)

Query: 520 PRDCVSCRNVSRGRECVDKCNLLEGEPREFV 550
    ||: :       |   |       ||||::|  
Sbjct: 17 PREDIKAMLRKNGDFLVRSTEPKAGEPRQYV 47
up-result list


Result 21 GP_NEW:CEK07F5_3
 

Z70284 Caenorhabditis elegans Caenorhabditis elegans cosmid
K07F5, complete sequence; predicted using Genefinder; Similarity to
Drosophila tyrosine-protein kinase FPS (SW:FPS_DROME).
Length = 517

Score = 284 (132.2 bits), Expect = 3.7e-31, P = 3.7e-31
Identities = 95/304 (31%), Positives = 157/304 (51%)

Query: 718 LGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKA-----NKEILDEAYVMASVDNP 772
    |||| |  ||:|:   :| |: ||||||  : :    |        :| || :| : :|   
Sbjct: 159 LGSGNFCIVYRGMLRKQG-KI-IPVAIKVSKNSDKESAALMETRNLLLAEARIMMNYNNI 216
Query: 773 HVCRLLGI-CLTSTVQLITQLMPFGCLLDYVREH-KD--NIGSQYLLNWCVQIAKGMNYL 828
    :| |: |: |      :  :    | | | :::: ||      | ||   :  |:|| ||  
Sbjct: 217 NVIRIYGVACDVPPFMVCMEFCSGGSLEDALKKYGKDMEEFERQILL---IDAARGMRYL 273
Query: 829 EDRRLVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILH 888
     |:: ||||||:|| |:     ||| ||||:| |  ::| :     : |: |:| | |    
Sbjct: 274 HDKKCVHRDLASRNCLISFDGIVKIADFGLSKTLEKDQKAFKEALKEAPLAWLAPECIQR 333
Query: 889 RI-YTHQSDVWSYGVTVWELMTFGSKPYDGIPASEISSILEKGERLPQPPICTID----V 943
       :: ::|||::|| ::|:     | : |    |  :|| | ::   | |        :  
Sbjct: 334 ESEFSTKTDVWAFGVVIFEVYNNAEKLFAG---EEDIAILRKIKKANMPTIENRTKVPAM 390
Query: 944 YMIMVKCWMIDADSRPKFRE----LIIEFSKMARDPQRYLVI---QGDERMHLPSPTDSN 996
      ::   |    | ||: ::    |:     :  |  : | |   :|  | ::|: ||    
Sbjct: 391 QAVLSSIWTRKPDDRPEMQKVLEKLVAALVPIQPDDLKRLQINSLKGVSRTQMPN-TDLE 449
Query: 997 FYRALMDEE-DMD 1008
       ::::|| | |  
Sbjct: 450 MDVSVVNEEVDQD 462
Score = 37 (17.2 bits), Expect = 2.4e+04, P = 1.0
Identities = 7/19 (36%), Positives = 13/19 (68%)

Query: 317 EMEEDGVRKCKKCEGPCRK 335
    |:::||  | :| :|  :|  
Sbjct: 458 EVDQDGSEKNRKVKGGSKK 476
up-result list


Result 22 GP_NEW:CEY69E1A_3
 

AL034365 Caenorhabditis elegans Caenorhabditis elegans
cosmid Y69E1A, complete sequence; similar to Eukaryotic protein
kinase domain. 12/98
Length = 563

Score = 280 (130.3 bits), Expect = 1.6e-30, P = 1.6e-30
Identities = 78/230 (33%), Positives = 123/230 (53%)

Query: 680 RRLLQERELVEPLTPSGE--APNQALLRILKETEFKKIKVLGSGAFGTVYKGLWIPEGE- 736
    || |: |:|:|  : :     |      :|  :     | || |||| |:|| :   |    
Sbjct: 164 RRFLHIRQLLEAWSQATPFLIPTPRGSNVLIHSTINLDKKLGCGAFGEVFKGQYKAVGST 223
Query: 737 KVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRLLGIC-LTSTVQLITQLMPF 795
       | ||:| :      |  :|  :|| :|  : : ::    |   |   : :: :|:    
Sbjct: 224 NPPIEVAVKRILGNAKRKQIQEFCNEAQIMTVLQHENIVAFYGFASLEEPIMVVMELVTG 283
Query: 796 GCLLDYVREHKDNIGSQYLLNWCVQIAKGMNYLEDRRLVHRDLAARNVLVKTPQHVKITD 855
    | |  | :  : ||    :| : : :| || :|  : ::|||||||| ||      ||:|  
Sbjct: 284 GDLRKYFQTTQ-NIPKLQILWFAMNVASGMRHLSSKGIIHRDLAARNCLVTQDLKAKISD 342
Query: 856 FGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDVWSYGVTVWELMT 909
    |||: | |    : : |  | ||:|:| ||:   ::  ::||||||| : ||||  
Sbjct: 343 FGLS-LQGTVTTK-NLE--KAPIRWLAPESLKSGLFNEKTDVWSYGVFLTELMT 392
up-result list


Result 23 GP_NEW:AF041792_1
 

AF041792 Gallus gallus Gallus gallus tyrosine kinase ERBB-4
(ERBB4) mRNA, partial cds. 1/99
Length = 68

Score = 247 (115.0 bits), Expect = 2.0e-28, P = 2.0e-28
Identities = 48/64 (75%), Positives = 57/64 (89%)

Query: 838 LAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYTHQSDV 897
    ||| |||||:| ||||||||||:||  :||||:|:|||:|||||||| | :| :||||||  
Sbjct: 5 LAASNVLVKSPNHVKITDFGLARLLEGDEKEYNADGGKMPIKWMALECIHYRKFTHQSDV 64
Query: 898 WSYG 901
    ||:|  
Sbjct: 65 WSFG 68
up-result list


Result 24 GP_NEW:AF110519_1
 

AF110519 Lycopersicon esculentum Lycopersicon esculentum
ethylene-inducible CTR1-like protein kinase mRNA, complete cds;
protein kinase homolog; ethylene and fruit ripening inducibl
Length = 806

Score = 260 (121.0 bits), Expect = 1.8e-27, P = 1.8e-27
Identities = 74/248 (29%), Positives = 127/248 (51%)

Query: 718 LGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRL 777
    :|:|:||||::| |   |  | : : :::   |   :  || | |  :|  : :|::     
Sbjct: 538 IGAGSFGTVHRGDW--HGSDVAVKILMEQDFHA---ERLKEFLREVAIMKRLRHPNIVLF 592
Query: 778 LGICLTS-TVQLITQLMPFGCLLDYVREH--KDNIGSQYLLNWCVQIAKGMNYLEDRR-- 832
    :|  :    : ::|: :  | |   : :   |  :  :  |     :| |||||  |     
Sbjct: 593 MGAVIQPPNLSIVTEYLSRGSLYRLLHKPGAKKVLDERRPLCLAYDVANGMNYLHKRNPP 652
Query: 833 LVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYT 892
    :||||| : |:||     ||| ||||::             |  | :||| | |        
Sbjct: 653 IVHRDLKSPNLLVDKKYTVKICDFGLSRFKANTFLSSKTAAG-TP-EWMAPEVIRDEPSN 710
Query: 893 HQSDVWSYGVTVWELMTFGSKPYDGI-PASEISSILEKGERLPQPPICTIDVYMIMVKCW 951
     :|||:|:|| :||| |   :|:: : |   |:::    ::|  | :    | :|:  ||  
Sbjct: 711 EKSDVYSFGVILWELATL-QQPWNKLNPPQVIAAVGFNRKKLDIPSVLNPRVAIIIEACW 769
Query: 952 MIDADSRPKFRELI 965
      :   || |  ::  
Sbjct: 770 ANEPWKRPSFSTIM 783
Score = 42 (19.5 bits), Expect = 8.8e+03, P = 1.0
Identities = 10/36 (27%), Positives = 15/36 (41%)

Query: 1032 TPLLSSLSATSNNSTVACIDRNGLQSCPIKEDSFLQ 1067
    |   ::    :  |  :||||| : |     |   |  
Sbjct: 401 TDFRAAADGDAGQSDRSCIDRNNVVSSSSNRDEISQ 436
Score = 37 (17.2 bits), Expect = 3.3e+04, P = 1.0
Identities = 9/35 (25%), Positives = 14/35 (40%)

Query: 980 VIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDAD 1014
    :: |   : :|||     || :    |     | |  
Sbjct: 376 LVNGPFSISIPSPLRFPRYRQVEPTTDFRAAADGD 410
up-result list


Result 25 GP_NEW:AF110518_1
 

AF110518 Lycopersicon esculentum Lycopersicon esculentum
ethylene-inducible CTR1-like protein kinase mRNA, complete cds;
protein kinase homolog; ethylene and fruit ripening inducibl
Length = 829

Score = 260 (121.0 bits), Expect = 1.9e-27, P = 1.9e-27
Identities = 74/248 (29%), Positives = 127/248 (51%)

Query: 718 LGSGAFGTVYKGLWIPEGEKVKIPVAIKELREATSPKANKEILDEAYVMASVDNPHVCRL 777
    :|:|:||||::| |   |  | : : :::   |   :  || | |  :|  : :|::     
Sbjct: 561 IGAGSFGTVHRGDW--HGSDVAVKILMEQDFHA---ERLKEFLREVAIMKRLRHPNIVLF 615
Query: 778 LGICLTS-TVQLITQLMPFGCLLDYVREH--KDNIGSQYLLNWCVQIAKGMNYLEDRR-- 832
    :|  :    : ::|: :  | |   : :   |  :  :  |     :| |||||  |     
Sbjct: 616 MGAVIQPPNLSIVTEYLSRGSLYRLLHKPGAKKVLDERRPLCLAYDVANGMNYLHKRNPP 675
Query: 833 LVHRDLAARNVLVKTPQHVKITDFGLAKLLGAEEKEYHAEGGKVPIKWMALESILHRIYT 892
    :||||| : |:||     ||| ||||::             |  | :||| | |        
Sbjct: 676 IVHRDLKSPNLLVDKKYTVKICDFGLSRFKANTFLSSKTAAG-TP-EWMAPEVIRDEPSN 733
Query: 893 HQSDVWSYGVTVWELMTFGSKPYDGI-PASEISSILEKGERLPQPPICTIDVYMIMVKCW 951
     :|||:|:|| :||| |   :|:: : |   |:::    ::|  | :    | :|:  ||  
Sbjct: 734 EKSDVYSFGVILWELATL-QQPWNKLNPPQVIAAVGFNRKKLDIPSVLNPRVAIIIEACW 792
Query: 952 MIDADSRPKFRELI 965
      :   || |  ::  
Sbjct: 793 ANEPWKRPSFSTIM 806
Score = 54 (25.1 bits), Expect = 2.0e+02, P = 1.0
Identities = 21/88 (23%), Positives = 34/88 (38%)

Query: 980 VIQGDERMHLPSPTDSNFYRALMDEEDMDDVVDADEYLIPQQGF---FSSPSTSRTPLLS 1036
    :: |   : :|||     || :    |   :  | :| :  |     |   |       :  
Sbjct: 376 LVNGPFSISIPSPLRFPRYRQVEPTTDFRSL--AKQYFLDSQSLNLLFDDSSAG-----A 428
Query: 1037 SLSATSNNSTVACIDRNGLQSCPIKEDSFLQ 1067
    :    :  |  :||||| : |     |   |  
Sbjct: 429 AADGDAGQSDRSCIDRNNVVSSSSNRDEISQ 459
up-result list



  up-alignments   down-end
Parameters:  gi 
prune 
hspmax=5000 
Processors=3 
Wordsize=3 
Expect1=10 
Expect2=0.15 
GapE=2000 
Initial Gap penalty=9 
Extended Gap penalty=2 
Comparison matrix=blosum60 
Number of descriptions=25 
Number of alignments=25 
sort_by_pvalue 
 
ctxfactor=1.00 
 
Query                        -----  As Used  -----    -----  Computed  ---- 
Frame  MatID Matrix name     Lambda    K       H      Lambda    K       H 
 +0      0   blosum60        0.323   0.133   0.405    same    same    same 
             Initial Gap penalty=9,R=2         0.323   0.133   0.405     n/a     n/a     n/a 
 
Query 
Frame  MatID  Length  Eff.Length     E    S W   T  X   E2     S2 
 +0      0     1210      1210       10.  61 3  11 22  0.064   37 
                                                  34  0.064   37 
 
 

    
More statistics:  Database: /sys/bio/local/blast/db/blastgenpeptnew/gp_new
Title: blastgenpeptnew/gp_new
Release date: unknown
Posted date: 11:17 PM CET Feb 9, 1999
Format: BLAST
# of letters in database: 9,242,616
# of sequences in database: 30,053
# of database sequences satisfying E: 384
No. of states in DFA: 571 (56 KB)
Total size of DFA: 326 KB (384 KB)
Time to generate neighborhood: 0.07u 0.01s 0.08t Elapsed: 00:00:00
No. of threads or processors used: 3
Search cpu time: 58.27u 1.15s 59.42t Elapsed: 00:01:08
Total cpu time: 58.48u 1.27s 59.75t Elapsed: 00:01:09
Start: Wed Feb 10 14:21:36 1999 End: Wed Feb 10 14:22:45 1999

up-top  
Credits:  Gish, Warren (1994-1997). unpublished.
Altschul, Stephen F., Warren Gish, Webb Miller, Eugene W. Myers, and David J.
Lipman (1990). Basic local alignment search tool. J. Mol. Biol. 215:403-10.
 


Copyright © 1997-1999, GeneData AG.